PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g048609m
Common NameCISIN_1g048609mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 421aa    MW: 47133.9 Da    PI: 8.6763
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g048609mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.93.2e-1732122199
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                        ffk+++ +d   s +l lp kfae  + +   +k+ ++ed+sg  Wev +  ++ +g+  +++GW+ F   ++L+ gDf+vF +++ s+f  
  orange1.1g048609m  32 FFKIMIGKDC--SEILFLPPKFAEMVSAV--IGKKAVIEDSSGDCWEVSV--SNVDGSPAFRQGWNAFSAYHRLEIGDFLVFDYIRGSRF-- 115
                        7788855544..4579*******999866..7889***************..99999****************************98999.. PP

                        EEEEE-S CS
                 B3  93 vvkvfrk 99 
                         vk+f+k
  orange1.1g048609m 116 IVKIFDK 122
                        *****98 PP

2B340.35.5e-133303962896
                        --..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                 B3  28 gkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                         + ++ k ++l+d++ r W v +    +sg  vlt+GW+ F kan+++ gD ++F +++ se  + v++
  orange1.1g048609m 330 RSRTQRKVVVLRDPDMRMWPVLY--HERSGFKVLTSGWEAFSKANNIQPGDGCIFGVESYSESIYGVSI 396
                        44567789***************..******************************97665655555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.7E-2226125IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-2228125IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.12530123IPR003340B3 DNA binding domain
CDDcd100172.28E-1830121No hitNo description
PfamPF023627.4E-1432122IPR003340B3 DNA binding domain
SMARTSM010194.4E-1132123IPR003340B3 DNA binding domain
SMARTSM010190.084315395IPR003340B3 DNA binding domain
SuperFamilySSF1019361.92E-13320388IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.9E-13321388IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.969322400IPR003340B3 DNA binding domain
PfamPF023627.0E-10329390IPR003340B3 DNA binding domain
CDDcd100172.47E-10335382No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGGKVEACAE CTKKCLLVHR NKAKLSPVIH SFFKIMIGKD CSEILFLPPK FAEMVSAVIG  60
KKAVIEDSSG DCWEVSVSNV DGSPAFRQGW NAFSAYHRLE IGDFLVFDYI RGSRFIVKIF  120
DKTGCEKQKI SLTMNKRKRY RTRTNFTDRE GQCYTADTGN NCGTAIRDKM KDGDDYSHHA  180
DASLISEFED VLVNKYLVDK EIPNRVAASH ASDMDIMKNN GVEKTEQIIS RVELQKDGGN  240
NSNVSSGVSQ KCHGAEEESK ALSRNLPQLI KVERGLRYDM IGREYGISQV VKTETLDLVP  300
TSYIPCATPS DGQPFLELST CLPTSSFRGR SRTQRKVVVL RDPDMRMWPV LYHERSGFKV  360
LTSGWEAFSK ANNIQPGDGC IFGVESYSES IYGVSIVRKH LLRRCLSTVL PNYIINSLRK  420
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006440024.11e-110hypothetical protein CICLE_v10019558mg
RefseqXP_015385275.11e-110PREDICTED: uncharacterized protein LOC102617961 isoform X4
TrEMBLA0A067G0W30.0A0A067G0W3_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1853758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.11e-14B3 family protein